.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q82

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and dynamics of the P7 protein from the bacteriophage phi 12. J.Mol.Biol. 382 402-422 2008
    Site NESGC
    PDB Id 2q82 Target Id OC1
    Molecular Characteristics
    Source Other
    Alias Ids TPS8989, Molecular Weight 14063.54 Da.
    Residues 129 Isoelectric Point 4.47
    Sequence mdfitdmsknqrlelqnrlaqyetslmvmshngdvpvitgfnvmrvttmldalkvelpavavlgddaqd layvfgarplavgvniirvvdvpgqqpsalvdaelgalhevsmvrvlndiadeqlvkanm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.83 Rfree 0.226
    Matthews' coefficent 2.65 Rfactor 0.210
    Waters 188 Solvent Content 53.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2q82
    1. Three-dimensional structure of the enveloped bacteriophage _12: An incomplete T= 13 lattice is superposed on an enclosed T= 1 shell
    H Wei, RH Cheng, J Berriman, WJ Rice, DL Stokes - PLoS One, 2009 - dx.plos.org
     
    2. Roles of the Minor Capsid Protein P7 in the Assembly and Replication of Double-Stranded RNA Bacteriophage 6
    MM Poranen, SJ Butcher, VM Simonov - Journal of molecular , 2008 - Elsevier
     
    3. Structure and Dynamics of the P7 Protein from the Bacteriophage _12
    E Eryilmaz, J Benach, M Su, J Seetharaman - Journal of molecular , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch