The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the NHN endonuclease from Geobacter metallireducens. To be Published
    Site NESGC
    PDB Id 2qgp Target Id GmR87
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS8899,PF01844, BIG_704 Molecular Weight 12198.25 Da.
    Residues 104 Isoelectric Point 5.76
    Sequence mnyfivevseqevkrekekarelrrsqwwknriargichycgeifppeeltmdhlvpvvrggkstrgnv vpackecnnrkkyllpveweeyldslesepsdgeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.2964
    Matthews' coefficent 2.35 Rfactor 0.2348
    Waters 15 Solvent Content 47.73

    Ligand Information
    Metals ZN (ZINC) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch