.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the phospholipid-binding protein from Ralstonia solanacearum Q8XV73_RALSQ in complex with a phospholipid at the resolution 1.53 A. To be Published
    Site NESGC
    PDB Id 2qgu Target Id RsR89
    Molecular Characteristics
    Source Ralstonia solanacearum
    Alias Ids TPS9060,3.10.450.50, PF05494, 1.10.10.640 Molecular Weight 23271.28 Da.
    Residues 211 Isoelectric Point 9.40
    Sequence mfkkllhslfagltfmaavaavpahaqeadaqttvktavddvlatikgdsdlrsgnmqkvfqlvdqkiv pradfkrttqiamgrfwsqatpeqqqqiqdgfktllvrtyagalanvrnqtvsykpfraaaddtdvvvr stvnnngepvaldyrmeksangwkvydinisglwlsetyknqfaeviskrggvsglvqfldernaqlak gpak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.21142
    Matthews' coefficent 2.50 Rfactor 0.18535
    Waters 356 Solvent Content 50.84

    Ligand Information
    Ligands PEF (DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qgu
    1. Structural and thermodynamic characterization of the interaction between two periplasmic Treponema pallidum lipoproteins that are components of a TPR-
    CA Brautigam, RK Deka, P Schuck - Journal of Molecular , 2012 - Elsevier
     
    2. INSILICO EXPRESSION AND IDENTIFICATION OF DRUG TARGET IN Aeromonas hydrophila
    A GANESH - 2008 - digitallibrary.srmuniv.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch