.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hydrogenase-1 operon protein hyaE from Shigella flexneri. To be Published
    Site NESGC
    PDB Id 2qgv Target Id SfR170
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9128,PF07449, 3.40.30.10 Molecular Weight 14841.91 Da.
    Residues 132 Isoelectric Point 4.49
    Sequence msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmigellhefpdyt wqvaiadleqseaigdrfgafrfpatlvftggnyrgvlngihpwaelinlmrglvepqqeras
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.70 Rfree 0.292
    Matthews' coefficent 2.36 Rfactor 0.253
    Waters Solvent Content 47.81

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qgv
    1. Chaperones specific for the membrane_bound [NiFe]_hydrogenase interact with the Tat signal peptide of the small subunit precursor in Ralstonia eutropha H16
    T Schubert, O Lenz, E Krause, R Volkmer - Molecular , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch