.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative primosome component from Streptococcus pyogenes serotype M3. To be Published
    Site NESGC
    PDB Id 2qgz Target Id DR58
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8815,PF07319, PF00308, 3.40.50.300, PF00910, PF03969, PF01695 Molecular Weight 34144.03 Da.
    Residues 300 Isoelectric Point 5.49
    Sequence mekigetmaklgqntrvnsdqliqtiladpevasfisqhhlsqeqinlslskfnqflverqkyqlkdps yiakgyqpilamnegyadvsyletkelveaqkqaaiseriqlvslpksyrhihlsdidvnnasrmeafs aildfveqypsaeqkglylygdmgigksyllaamahelsekkgvsttllhfpsfaidvknaisngsvke eidavknvpvlilddigaeqatswvrdevlqvilqyrmleelptfftsnysfadlerkwatikgsdetw qakrvmervrylarefhleganrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.254
    Matthews' coefficent 2.46 Rfactor 0.234
    Waters 92 Solvent Content 50.02

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qgz
    1. Molecular Interplay between the Replicative Helicase DnaC and Its Loader Protein DnaI from Geobacillus kaustophilus
    KL Tsai, YH Lo, YJ Sun, CD Hsiao - Journal of molecular biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch