.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qik

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YkqA from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2qik Target Id SR631
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9115,3.10.490.10, PF06094, BIG_748 Molecular Weight 31657.27 Da.
    Residues 277 Isoelectric Point 6.22
    Sequence mnsllfvygtlrkheknhhllaqsacineqartkgslfaakegptvvfndedegyiygevyeadelcih kldqffqgyhkqtvfvetdvgikialiyfmnkdgcagftkissgdwkehqmisksknpiyyfaygscmd narfqkagvdhyfqdpvgravlkgyttrftlkredgsradmledggttegvlyripysalsylykregv esltyrpafvdveaggrhykdcltflvlqkeaeiappqhyqieiergaelylspefteklkrhmnslpkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.176
    Matthews' coefficent 1.91 Rfactor 0.131
    Waters 446 Solvent Content 35.68

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 2qik
    1. Identification and Characterization of _-Glutamylamine Cyclotransferase, an Enzyme Responsible for _-Glutamyl-_-lysine Catabolism
    AJ Oakley, M Coggan, PG Board - Journal of Biological Chemistry, 2010 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch