.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qti

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the UPF0352 protein SO_2176 from Shewanella oneidensis. To be Published
    Site NESGC
    PDB Id 2qti Target Id SoR77
    Related PDB Ids 2juw 
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9154,1.10.3390.10, PF07208, 15456 Molecular Weight 7864.69 Da.
    Residues 72 Isoelectric Point 7.92
    Sequence maiqskysntqvesliaeilvvlekhkaptdlslmalgncvthllerkvpsesrqavaeqfakalaqsv ksn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.232
    Matthews' coefficent 2.21 Rfactor 0.223
    Waters 19 Solvent Content 44.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch