The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of the putative sulfatase yidJ from Bacteroides fragilis. To be Published
    Site NESGC
    PDB Id 2qzu Target Id BfR123
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS8755,PF00884, PF01663, 3.40.720.10, PF02995, 3.30.1120.10, BIG_630 Molecular Weight 55293.00 Da.
    Residues 483 Isoelectric Point 6.33
    Sequence mkniipqalltmpilstglqaqekqptpnlvfimadqyrgdaigcigkepvktphldklaseginftna issypvsspargmlmtgmypigskvtgncnsetapygvelsqnarcwsdvlkdqgynmgyigkwhldap ykpyvdtynnrgkvawnewcpperrhgfdhwiaygtydyhlkpmywnttaprdsfyyvnqwgpeyeask aieyingqkdqkqpfalvvsmnpphtgyelvpdrykeiykdldvealckgrpdipakgtemgdyfrnni rnyyacitgvdenvgriiealkqnnlfdntivvftsdhgicmgahenagkdifyeesmripmilswpdq ikprksdplmiafadlyptllsmmgfskeipetvqtfdlsnevltgknkkdlvqpyyfvkfdnhatgyr glrtdrytyavhatdgkidnvilfdrtndphemnniasqqlklthtfnrqlktwlektndpfaqyiklk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.217
    Matthews' coefficent 2.12 Rfactor 0.195
    Waters 457 Solvent Content 41.92

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch