.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r6z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the SAM-dependent methyltransferase NGO1261 from Neisseria gonorrhoeae. To be Published
    Site NESGC
    PDB Id 2r6z Target Id NgR48
    Molecular Characteristics
    Source Neisseria gonorrhoeae
    Alias Ids TPS8988,3.40.1630.10, PF04445, 3.40.50.150 Molecular Weight 27314.73 Da.
    Residues 250 Isoelectric Point 8.89
    Sequence mtdiliddtateavrtlirafplvpvsqppeqgsyllaehdtvslrlvgeksnvivdftsgaaqyrrtk gggeliakavnhtahptvwdataglgrdsfvlaslgltvtafeqhpavacllsdgirrallnpetqdta arinlhfgnaaeqmpalvktqgkpdivyldpmyperrksaavkkemayfhrlvgeaqdevvllhtarqt akkrvvvkrprlgehlagqapayqytgkstrfdvylpygadkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.231
    Matthews' coefficent 2.26 Rfactor 0.215
    Waters 453 Solvent Content 45.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r6z
    1. YhiQ is RsmJ, the methyltransferase responsible for methylation of G1516 in 16S rRNA of E. coli
    GN Basturea, DR Dague, MP Deutscher - Journal of molecular , 2011 - Elsevier
     
    2. MarkUs: a server to navigate sequencestructurefunction space
    M Fischer, QC Zhang, F Dey, BY Chen - Nucleic Acids , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch