.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r7d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribonuclease II family protein from Deinococcus radiodurans. To be Published
    Site NESGC
    PDB Id 2r7d Target Id DrR63
    Related PDB Ids 2r7f 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8817,2.40.50.140, PF00773, 4.10.80.30, 1.10.10.10 Molecular Weight 50596.70 Da.
    Residues 461 Isoelectric Point 5.18
    Sequence mtqpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadrlraalnave lpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhvadvaalvapdspldlear argatlylpdrtigmlpdelvakaglglhevspalsicldldpdgnaeavdvlltrvkvqrlayqeaqa rleageepfvtlarlarasrrlregegalsidlpevrvkadetgasvfplpkpemrtvvqecmtlagwg taifaddneiplpfatqdyptrevagdtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrry ldlvvhqqlraflagrdplsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqpervwdavvvdr rgaqatllipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.80 Rfree 0.243
    Matthews' coefficent 2.88 Rfactor 0.221
    Waters 1242 Solvent Content 57.29

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2r7d
    1. The Structure and Enzymatic Properties of a Novel RNase II family enzyme from Deinococcusradiodurans
    BJ Schmier, J Seetharaman, MP Deutscher - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch