The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribonuclease II family protein from Deinococcus radiodurans. To be Published
    Site NESGC
    PDB Id 2r7f Target Id DrR63
    Related PDB Ids 2r7d 
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8818,, PF00773,, Molecular Weight 50596.70 Da.
    Residues 461 Isoelectric Point 5.18
    Sequence mtqpeltpaqrtevellargradksrvlrdlklpetpeaahalllrlgvwdeartpyadrlraalnave lpvpdfdpaeerldlthlptfaiddegnqdpddavgvedlgggltrlwvhvadvaalvapdspldlear argatlylpdrtigmlpdelvakaglglhevspalsicldldpdgnaeavdvlltrvkvqrlayqeaqa rleageepfvtlarlarasrrlregegalsidlpevrvkadetgasvfplpkpemrtvvqecmtlagwg taifaddneiplpfatqdyptrevagdtlpamwarrktlartrfqpspgphhgmgldlyaqatspmrry ldlvvhqqlraflagrdplsskvmaahiaesqmnadatrqaerlsrrhhtlrfiaaqpervwdavvvdr rgaqatllipdlafdvqvntpaapgtalqvqfadidlpqmrvrarsv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.244
    Matthews' coefficent 2.78 Rfactor 0.201
    Waters 143 Solvent Content 55.81

    Ligand Information


    Google Scholar output for 2r7f
    1. The Structure and Enzymatic Properties of a Novel RNase II family enzyme from Deinococcusradiodurans
    BJ Schmier, J Seetharaman, MP Deutscher - Journal of Molecular , 2011 - Elsevier

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch