.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ra2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the Q7CPV8 protein from Salmonella typhimurium at the resolution 1.9 A. To be Published
    Site NESGC
    PDB Id 2ra2 Target Id StR88A
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9180,2.30.30.100, PF06004 Molecular Weight 6200.53 Da.
    Residues 56 Isoelectric Point 4.99
    Sequence msgpnyvmhtndgrsivtdgkpqtdndtgmisykdangnkqqinrtdvkemvalen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.251
    Matthews' coefficent 2.29 Rfactor 0.228
    Waters 236 Solvent Content 46.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ra2
    1. Studies on the inference of protein binding regions across fold space based on structural similarities
    J Teyra, J Hawkins, H Zhu - : Structure, Function, and , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch