The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q64V53_BACFR protein from Bacteroides fragilis. To be Published
    Site NESGC
    PDB Id 2ra8 Target Id BfR43
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS8758,,, PF05406 Molecular Weight 40113.65 Da.
    Residues 354 Isoelectric Point 4.63
    Sequence mkrvfvfqdfksqkfwsidvrgtdvivnygklgtdgqtqvknfssageaekaagkliaektkkgyvetl eevakemkveakkyalsydeaeegvnlmdkilkdkklpslkqitigcwgyegedcsdiadgivenkekf ahfeglfwgdidfeeqeiswieqvdlspvldampllnnlkikgtnnlsigkkprpnlksleiisgglpd svvedilgsdlpnleklvlyvgvedygfdgdmnvfrplfskdrfpnlkwlgivdaeeqnvvvemflesd ilpqletmdisagvltdegarllldhvdkikhlkfinmkynylsdemkkelqkslpmkidvsdsqeydd dysypmite
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.247
    Matthews' coefficent 2.36 Rfactor 0.225
    Waters 230 Solvent Content 47.91

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch