.
The Open Protein Structure Annotation Network
PDB Keyword
.

2raq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the MTH889 protein from Methanothermobacter thermautotrophicus. To be Published
    Site NESGC
    PDB Id 2raq Target Id TT205
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9200,PF02680, 3.30.70.100, 3.30.70.1340 Molecular Weight 10810.76 Da.
    Residues 97 Isoelectric Point 4.50
    Sequence mvakglirivldilkphepiipeyakylselrgvegvnitlmeidketenikvtiqgndldfdeitrai esyggsihsvdevvagrtmveevttpqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 3.11 Rfree 0.2802
    Matthews' coefficent 2.41 Rfactor 0.21559
    Waters 54 Solvent Content 48.88

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 14

    Jmol

     
    Google Scholar output for 2raq
    1. Beta-Strand Interfaces of Non-Dimeric Protein Oligomers Are Characterized by Scattered Charged Residue Patterns
    G Feverati, M Achoch, J Zrimi, L Vuillon, C Lesieur - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch