.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the protein Q8EI81. To be Published
    Site NESGC
    PDB Id 2rb6 Target Id SoR78A
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9156,2.30.30.100, PF06004 Molecular Weight 6198.76 Da.
    Residues 53 Isoelectric Point 4.85
    Sequence mssqyimstkdgkmitsdskpkldkttgmylyydedgrevmikqedvtqiier
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.28
    Matthews' coefficent 2.46 Rfactor 0.241
    Waters 46 Solvent Content 49.93

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch