The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the protein Q7CQI7. To be Published
    Site NESGC
    PDB Id 2rd1 Target Id StR87A
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9179,, PF06004 Molecular Weight 6008.35 Da.
    Residues 54 Isoelectric Point 4.76
    Sequence mttnyvmttkngqtivtqgkpqldketgmtsytdqegnqreinsndvaqlikad
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 1.95 Rfactor 0.207
    Waters 47 Solvent Content 36.85

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch