.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rhk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for suppression of a host antiviral response by influenza A virus. Proc.Natl.Acad.Sci.Usa 105 13093-13098 2008
    Site NESGC
    PDB Id 2rhk Target Id HR6309A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28411,4.10.1000.10, PF00642 Molecular Weight 7184.91 Da.
    Residues 61 Isoelectric Point 6.25
    Sequence sgektvvckhwlrglckkgdqceflheydmtkmsecyfyskfgecsnkecpflhidpeski
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.234
    Matthews' coefficent 2.72 Rfactor 0.210
    Waters 185 Solvent Content 54.74

    Ligand Information
    Ligands NO3 (NITRATE) x 5;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 2rhk
    1. The multifunctional NS1 protein of influenza A viruses
    BG Hale, RE Randall, J Ortn - Journal of General , 2008 - Soc General Microbiol
     
    2. Structural basis for suppression of a host antiviral response by influenza A virus
    K Das, LC Ma, R Xiao, B Radvansky - Proceedings of the , 2008 - National Acad Sciences
     
    3. X-ray structures of NS1 effector domain mutants
    S Xia, JD Robertus - Archives of biochemistry and biophysics, 2010 - Elsevier
     
    4. A transient homotypic interaction model for the influenza A virus NS1 protein effector domain
    PS Kerry, J Ayllon, MA Taylor, C Hass, A Lewis - PLoS One, 2011 - dx.plos.org
     
    5. Genomic and protein structural maps of adaptive evolution of human influenza A virus to increased virulence in the mouse
    J Ping, L Keleta, NE Forbes, S Dankar, W Stecho - PloS one, 2011 - dx.plos.org
     
    6. Differential Effects of NS1 Proteins of Human Pandemic H1N1/2009, Avian Highly Pathogenic H5N1, and Low Pathogenic H5N2 Influenza A Viruses on Cellular Pre-
    DE Kainov, KH Mller, LL Theisen - Journal of Biological , 2011 - ASBMB
     
    7. Structural biology of poly (A) site definition
    Q Yang, S Doubli - Wiley Interdisciplinary Reviews: RNA, 2011 - Wiley Online Library
     
    8. Cysteine and histidine shuffling: mixing and matching cysteine and histidine residues in zinc finger proteins to afford different folds and function
    JL Michalek, AN Besold, SLJ Michel - Dalton Trans., 2011 - xlink.rsc.org
     
    9. Recent progress in structure-based anti-influenza drug design
    J Du, TA Cross, HX Zhou - Drug Discovery Today, 2012 - Elsevier
     
    10. Structural Insights into the Function of Influenza NS1
    ZA Bornholdt, B Carrillo - Influenza: Molecular , 2010 - books.google.com
     
    11. Investigation of causes of oseltamivir chemoprophylaxis failures during influenza A (H1N1-2009) outbreaks
    VJ Lee, J Yap, S Maurer-Stroh, RTC Lee - Journal of Clinical , 2011 - Elsevier
     
    12. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch