.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b55

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q81BN2_BACCR protein from Bacillus cereus. To be Published
    Site NESGC
    PDB Id 3b55 Target Id BcR135
    Related PDB Ids 2rad 
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8748,3.40.1660.10, 3.30.1870.10, 1.20.1440.30, PF05139 Molecular Weight 50085.86 Da.
    Residues 443 Isoelectric Point 8.99
    Sequence mkkkiiiaivasaitmthfvgntyadsktevsvtapyntnqiakwleahakplkttnptaslndlkplk nmvgsasivglgeathgahevftmkhrivkylvsekgftnlvleegwdraleldryvltgkgnpsqhlt pvfktkemldlldwirqynanpkhkskvrvigmdiqsvnenvynniieyikannskllprveekikgli pvtkdmntfesltkeekekyvldakqisalleenksylngkskefawikqnariieqfttmlatppdkp adfylkhdiamyenakwteehlgktivwghnghvsktnmlsfiypkvagqhlaeyygkryvsigtsvye gqynvknsdgefgpygtlksddpnsynyifgqvkkdqffidlrkangvtktwlneqhpifagittegpd ipktvdislgkafdilvqiqkvspsqvhq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.214
    Matthews' coefficent 1.96 Rfactor 0.187
    Waters 168 Solvent Content 37.24

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3b55
    1. Mechanism and Diversity of the Erythromycin Esterase Family of Enzymes
    M Morar, K Pengelly, K Koteva, GD Wright - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch