.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b6y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of the Second HIN Domain of IFI16. To be Published
    Site NESGC
    PDB Id 3b6y Target Id HR4626A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8920,2.40.50.140, PF02760 Molecular Weight 25811.26 Da.
    Residues 227 Isoelectric Point 7.84
    Sequence rlktepeevsiedsaqsdlkevmvlnatesfvyepkeqkkmfhatvatenevfrvkvfnidlkekftpk kiiaianyvcrngflevypftlvadvnadrnmeipkglirsasvtpkinqlcsqtkgsfvngvfevhkk nvrgeftyyeiqdntgkmevvvhgrlntinceegdklkltsfelapksgntgelrsvihshikviktrk nkkdilnpdssmetspdfff
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.292
    Matthews' coefficent 2.21 Rfactor 0.226
    Waters 17 Solvent Content 44.40

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3b6y
    1. RPA nucleic acid-binding properties of IFI16-HIN200
    H Yan, K Dalal, BK Hon, P Youkharibache - et Biophysica Acta (BBA , 2008 - Elsevier
     
    2. Interferon-inducible protein 16: insight into the interaction with tumor suppressor p53
    JCC Liao, R Lam, V Brazda, S Duan, M Ravichandran - Structure, 2011 - Elsevier
     
    3. Structures of the HIN Domain: DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor
    T Jin, A Perry, J Jiang, P Smith, JA Curry - Immunity, 2012 - Elsevier
     
    4. Identification of CCR2_binding features in Cytl1 by a CCL2_like chemokine model
    A Tomczak, MT Pisabarro - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     
    5. Crystallographic characterization of mouse AIM2 HIN-200 domain bound to a 15 bp and an 18 bp double-stranded DNA
    MW Sung, T Watts, P Li - Acta Crystallographica Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch