.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bb6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the P64488 from E.coli (strain K12). To be Published
    Site NESGC
    PDB Id 3bb6 Target Id ER596
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8863,BIG_653, PF09313, 2.60.120.10 Molecular Weight 13610.81 Da.
    Residues 119 Isoelectric Point 6.03
    Sequence mlqipqnyihtrstpfwnkqtapagiferhldkgtrpgvyprlsvmhgavkylgyadehsaepdqvili eagqfavfppekwhnieamtddtyfnidffvapevlmegaqqrkvihngk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.261
    Matthews' coefficent 2.62 Rfactor 0.219
    Waters 185 Solvent Content 53.12

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3bb6
    1. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch