.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bf2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis. To be Published
    Site NESGC
    PDB Id 3bf2 Target Id MR36A
    Molecular Characteristics
    Source Neisseria meningitidis
    Alias Ids TPS8961,PF04390, 3.30.160.150 Molecular Weight 15989.40 Da.
    Residues 144 Isoelectric Point 5.47
    Sequence mgfhlkgadgisppltyrswhieggqalqfpletalyqasgrvddaagaqmtlridsvsqnketytvtr aavineylliltveaqvlkrgepvgkpmtvsvrrvlayadneilgkqeeeaalwaemrqdaaeqivrrl tflkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.258
    Matthews' coefficent 2.84 Rfactor 0.226
    Waters 38 Solvent Content 56.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bf2
    1. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel
    E Freinkman, SS Chng - Proceedings of the , 2011 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch