.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bhp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the UPF0291 protein ynzC from Bacillus subtilis at the resolution 2.0 A. To be Published
    Site NESGC
    PDB Id 3bhp Target Id SR384
    Related PDB Ids 2hep 2jvd 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9087,1.10.287.540, PF05979, 15476, 7225 Molecular Weight 8805.72 Da.
    Residues 77 Isoelectric Point 9.79
    Sequence misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmkntlksvkiidpegndvtpeklkr eqrnnklh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.01 Rfree 0.2623
    Matthews' coefficent 2.46 Rfactor 0.2289
    Waters 196 Solvent Content 49.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bhp
    1. Quantum chemical 13C_ chemical shift calculations for protein NMR structure determination, refinement, and validation
    JA Vila, JM Aramini, P Rossi, A Kuzin - Proceedings of the , 2008 - National Acad Sciences
     
    2. Assessing the accuracy of protein structures by quantum mechanical computations of 13C_ chemical shifts
    JA Vila, HA Scheraga - Accounts of chemical research, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch