.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bid

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the NMB1088 protein from Neisseria meningitidis. To be Published
    Site NESGC
    PDB Id 3bid Target Id MR91
    Molecular Characteristics
    Source Neisseria meningitidis
    Alias Ids TPS8962,BIG_655, PF07411, 3.30.160.160 Molecular Weight 6402.94 Da.
    Residues 56 Isoelectric Point 7.88
    Sequence myfeiykdakgeyrwrlkaanheiiaqgegytskqncqhavdllksttaatpvkev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.290
    Matthews' coefficent 2.16 Rfactor 0.241
    Waters 28 Solvent Content 43.12

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bid
    1. I_TASSER: Fully automated protein structure prediction in CASP8
    Y Zhang - Proteins: Structure, Function, and Bioinformatics, 2009 - Wiley Online Library
     
    2. Protein structure prediction: when is it useful?
    Y Zhang - Current opinion in structural biology, 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch