.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bij

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein GSU0716 from Geobacter sulfurreducens. To be Published
    Site NESGC
    PDB Id 3bij Target Id GsR13
    Molecular Characteristics
    Source Geobacter sulfurreducens
    Alias Ids TPS8900,3.40.50.1460, PF00656 Molecular Weight 29963.40 Da.
    Residues 277 Isoelectric Point 7.63
    Sequence mpkgialalglnavdpkhyggwagklnaceadaedmaaiaaergfavttlmtkaatrakvidaigkaak algkgdifmlsysghggqvpdtsndepdgvdetwclfdgeliddelyallgkfaagvrvlvfsdschsg tvvkmayyngttaarsagpdegeiryrampqsvamrtyranrefydtiqqktkkvdladvkasillisg cqdnqlsqdgafngaftgqllrvwknglykgsyrsfhkaivrrmppdqtpnfftagtpdpaflkqrpftv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.50 Rfree 0.267
    Matthews' coefficent 2.15 Rfactor 0.207
    Waters 141 Solvent Content 42.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bij
    1. Prediction of a caspase-like fold in Tannerella forsythia virulence factor PrtH
    J Pei, NV Grishin - Cell Cycle, 2009 - orphanresearch.com
     
    2. New aspects of the molecular evolution of legumains, Asn-specific cysteine proteinases
    AD Shutov, FR Blattner, IA Kakhovskaya - Journal of Plant , 2011 - Elsevier
     
    3. Molecular cloning and phylogenetic analysis of cereal type II metacaspase cDNA from wheat
    E Piszczek, M Dudkiewicz, M Sobczak - Biologia Plantarum, 2011 - Springer
     
    4. Crystal structure of the yeast metacaspase Yca1
    AHH Wong, C Yan, Y Shi - Journal of Biological Chemistry, 2012 - ASBMB
     
    5. Biochemical and Bioinformatic Characterization of Type II Metacaspase Protein (TaeMCAII) from Wheat
    E Piszczek, M Dudkiewicz, M Mielecki - Plant Molecular Biology Reporter, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch