.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bu2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a tRNA-binding protein from Staphylococcus saprophyticus subsp. saprophyticus. To be Published
    Site NESGC
    PDB Id 3bu2 Target Id SyR77
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS9184,PF01588, 3.30.1940.10, 2.40.50.140 Molecular Weight 21376.26 Da.
    Residues 199 Isoelectric Point 4.63
    Sequence mnlfynkeavgdvaflqinptegeynyvtqgdvveiqndgevvgynifnasnkatltgnghikltetlv qafqkaieaagftykldadftpkfvvgyvetkdkhpdadklsvlsvdvateklqivcgapnveagqkvv vakvgavmpsgmvikdaelrgvassgmicsmkelglpnapqekgimvlsddytvgqsffev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.273
    Matthews' coefficent 2.43 Rfactor 0.25
    Waters 191 Solvent Content 49.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3bu2
    1. KINARI-BioAssembly Case Study: 3SAQ
    TQ Liu - 2012 - kinari.cs.umass.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch