.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c0b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the conserved archaeal protein Q6M145. To be Published
    Site NESGC
    PDB Id 3c0b Target Id MrR63
    Related PDB Ids 3cet 
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS8979,PF01968, 3.30.420.40, 3.30.420.190 Molecular Weight 35905.83 Da.
    Residues 326 Isoelectric Point 4.89
    Sequence milgidiggantkitelhengefkvhhlyfpmwknndklaevlktyskdishvalvttaeladsyetkk egvdnilnaaesafgsnisvfdsdgnfislegaktnymkvsasnwcgtakwvsknieencilvdmgstt tdiipivdgkvvaektdlerlmnhellyvgtlrtpishlgntilfkgvntnvsseyfaitadisvvlek vtteeytcdtpdgkgtdkrsslvriskvlcsdldqiseidaeniaktyyelwkelilenvkkvaekygs kkvvitgigenilkdalgdfevisvaerygkdvslatpsfavaellknel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.2594
    Matthews' coefficent 2.68 Rfactor 0.2141
    Waters 160 Solvent Content 54.16

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3c0b
    1. Monitoring the glycosylation status of proteins using Raman spectroscopy
    VL Brewster, L Ashton, R Goodacre - Analytical Chemistry-Columbus, 2011 - biospec.net
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch