.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c0d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative nitrite reductase NADPH (small subunit) oxidoreductase protein Q87HB1. To be Published
    Site NESGC
    PDB Id 3c0d Target Id VpR162
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9238,BIG_827, 2.102.10.10 Molecular Weight 12345.65 Da.
    Residues 111 Isoelectric Point 4.89
    Sequence maaltkvklcqlddlmpfigatvliegervalfyipdsgvyavqdwdpigkayvmsrgivgdingemcv asplykqhfslksgqcledeahclktwrvtvddnqvcylake
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.274
    Matthews' coefficent 2.43 Rfactor 0.241
    Waters 79 Solvent Content 49.35

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch