.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c3d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Molecular insights into the biosynthesis of the f420 coenzyme. J.Biol.Chem. 283 11832-11840 2008
    Site NESGC
    PDB Id 3c3d Target Id MaR46
    Related PDB Ids 3cgw 3c3e 
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS8968,3.40.50.10680, 1.10.8.240, PF01933 Molecular Weight 33355.23 Da.
    Residues 303 Isoelectric Point 4.69
    Sequence miifsggtgtpklldglkeilpeeeltvvvntaedlwvsgnlispdldtvlylfsdqidrkrwwgiend tfgtyermkelgieeglklgdrdrathiirsniirdgasltdstvklsslfgikanilpmsddpvstyi etaegimhfqdfwigkrgepdvrgvdirgvseasispkvleafekeeniligpsnpitsigpiislpgm rellkkkkvvavspiignapvsgpagklmpacgievssmgvaeyyqdfldvfvfderdradefaferlg chasradtlmtstekskelaeivvqaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.50 Rfree 0.231
    Matthews' coefficent 4.82 Rfactor 0.195
    Waters 493 Solvent Content 74.48

    Ligand Information
    Ligands FO1 (1-DEOXY-1-(8-HYDROXY-2,4-DIOXO-3,4-DIHYDROPYRIMIDO[4,) x 4;PO4 (PHOSPHATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3c3d
    1. Recent advances in the research and development of B-Raf inhibitors
    HF Li, Y Chen, SS Rao, XM Chen - Current medicinal , 2010 - ingentaconnect.com
     
    2. Molecular insights into the biosynthesis of the F420 coenzyme
    F Forouhar, M Abashidze, H Xu, LL Grochowski - Journal of Biological , 2008 - ASBMB
     
    3. CR-2 Binding Peptide P28 as Molecular Adjuvant for DNA Vaccines
    ES Bergmann-Leitner, E Angov - US Patent App. 12/ , 2008 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch