.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c4n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DR_0571 protein from Deinococcus radiodurans in complex with ADP. To be Published
    Site NESGC
    PDB Id 3c4n Target Id DrR125
    Molecular Characteristics
    Source Deinococcus radiodurans
    Alias Ids TPS8816,3.50.50.60, 3.40.50.720, 3.30.9.10, PF01266 Molecular Weight 41135.60 Da.
    Residues 397 Isoelectric Point 5.77
    Sequence mtgpepvpagpppdptpprragsvwahvgqhfteeafdivvigagrmgaacafylrqlapgrslllvee gglpneegatilapgvwtaqdipagqeaqaewtreqllgalgsgktlevedrpllhllpagegsgltpt ldaladfpealalldparlpvarvdpraltyrpgslallaaqqaigqgaglllntraelvpggvrlhrl tvtnthqivvhetrqiragviivaagaagpalveqglglhtrhgrayrqfprldllsgaqtpvlrasgl tlrpqnggytlvpaihhrdphgyhpaggsltgvptglrrelledlvglmdavpalageglelgrssadv pgawlalpggrpdappqaeelapglhlllggpladtlglaaahelaqrvsag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.245
    Matthews' coefficent 2.80 Rfactor 0.211
    Waters 372 Solvent Content 56.00

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3c4n
    1. PDB
    JI Ito, Y Tabei, K Shimizu, K Tomii - : Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch