.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c4s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Ssl0352 protein from Synechocystis sp. To be Published
    Site NESGC
    PDB Id 3c4s Target Id SgR42
    Related PDB Ids 2jz2 
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS9135,PF11623, 15604, BIG_1284 Molecular Weight 6577.19 Da.
    Residues 58 Isoelectric Point 5.13
    Sequence mifpgatvrvtnvddtyyrfeglvqrvsdgkaavlfengnwdklvtfrlseleavkpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.194
    Matthews' coefficent 2.44 Rfactor 0.186
    Waters 149 Solvent Content 49.63

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3c4s
    1. An Src homology 3 domain-like fold protein forms a ferredoxin binding site for the chloroplast NADH dehydrogenase-like complex in Arabidopsis
    H Yamamoto, L Peng, Y Fukao - The Plant Cell , 2011 - Am Soc Plant Biol
     
    2. Iterative optimization of molecular mechanics force fields from NMR data of full-length proteins
    DW Li, R Bru_schweiler - Journal of Chemical Theory and , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch