.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c5m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. To be Published
    Site NESGC
    PDB Id 3c5m Target Id VpR199
    Molecular Characteristics
    Source Vibrio parahaemolyticus
    Alias Ids TPS9240,2.130.10.10, 2.140.10.30, 2.120.10.30, 2.120.10.60, 2.130.10.120 Molecular Weight 44179.08 Da.
    Residues 388 Isoelectric Point 4.62
    Sequence makgdvitlnfetfvdsdtqvkvtrltptdvichrnyfyqkcftqdgkkllfagdfdgnrnyyllnlet qqavqltegkgdntfggfistderaffyvknelnlmkvdletleeqviytvdeewkgygtwvansdctk lvgieilkrdwqpltswekfaefyhtnptcrlikvdietgelevihqdtawlghpiyrpfddstvgfch egphdlvdarmwlvnedgsnvrkikehaegescthefwipdgsamayvsyfkgqtdrviykanpetlen eevmvmppcshlmsnfdgslmvgdgcdapvdvadadsyniendpflyvlntkaksaqklckhstswdvl dgdrqithphpsftpnddgvlftsdfegvpaiyiadvpesykh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.277
    Matthews' coefficent 2.94 Rfactor 0.234
    Waters 209 Solvent Content 58.12

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 3

    Jmol

     
    Google Scholar output for 3c5m
    1. A hierarchical classification of polysaccharide lyases for glycogenomics
    B Henrissat, V Lombard, T Bernard, C Rancurel - 2010 - tara.tcd.ie
     
    2. Structural and mechanistic classification of uronic acid-containing polysaccharide lyases
    ML Garron, M Cygler - Glycobiology, 2010 - Soc Glycobiology
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch