.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa. To be Published
    Site NESGC
    PDB Id 3c96 Target Id PaR240
    Molecular Characteristics
    Source Pseudomonas aeruginosa
    Alias Ids TPS9003,PF01494, PF00890, 3.50.50.60, 3.40.50.720 Molecular Weight 43642.08 Da.
    Residues 402 Isoelectric Point 5.69
    Sequence msepidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealaelglgpalaat aipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrerlgqqavrtglgverieer dgrvligardghgkpqalgadvlvgadgihsavrahlhpdqrplshggitmwrgvtefdrfldgktmiv andehwsrlvaypisarhaaegkslvnwvcmvpsaavgqldneadwnrdgrledvlpffadwdlgwfdi rdlltrnqlilqypmvdrdplphwgrgritllgdaahlmypmgangasqaildgielaaalarnadvaa alreyeearrptankiilanrerekeewaaasrpkteksaaleaitgsyrnqverpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.197
    Matthews' coefficent 2.07 Rfactor 0.183
    Waters 278 Solvent Content 40.60

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3c96
    1. Crystal structure of Bacteroides thetaiotaomicron TetX2: A tetracycline degrading monooxygenase at 2.8 resolution
    K Walkiewicz, M Davlieva, G Wu - Structure, Function, and , 2011 - Wiley Online Library
     
    2. Crystallization and preliminary X-ray crystallographic analysis of the tetracycline-degrading monooxygenase TetX2 from Bacteroides thetaiotaomicron
    G Volkers, L Schuldt, GJ Palm, GD Wright - Section F: Structural , 2010 - scripts.iucr.org
     
    3. Delineation of the Caffeine C-8 Oxidation Pathway in Pseudomonas sp. Strain CBB1 via Characterization of a New Trimethyluric Acid Monooxygenase and Genes
    SK Mohanty, CL Yu, S Das, TM Louie - Journal of , 2012 - Am Soc Microbiol
     
    4. Delineation of Caffeine C-8 Oxidation Pathway in Pseudomonas sp. CBB1: Characterization of a New Trimethyluric Acid Monooxygenase and Genes Involved in
    SK Mohanty, CL Yu, S Das, TM Louie - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch