.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cew

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a cupin protein (BF4112) from Bacteroides fragilis. Northeast Structural Genomics Consortium target BfR205. To be Published
    Site NESGC
    PDB Id 3cew Target Id BfR205
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS8757,PF07883, 2.60.120.10, 2.60.120.280 Molecular Weight 12537.56 Da.
    Residues 117 Isoelectric Point 5.44
    Sequence mknyqkmsvaqdarvelhdslaltgaevsinhlpagagvpfvhshkqneeiygilsgkgfitidgekie lqagdwlriapdgkrqisaasdspigflciqvkagslegytmtdgvvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.31 Rfree 0.246
    Matthews' coefficent 2.51 Rfactor 0.217
    Waters 313 Solvent Content 50.98

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3cew
    1. Homology modeling and function prediction of hABH1, involving in repair of alkylation damaged DNA
    S Das, AS Vidyarthi - Interdisciplinary Sciences: Computational Life , 2011 - Springer
     
    2. Identifying Proteins That Can Form Tyrosine-Cysteine Crosslinks
    RJ Martinie, PI Godakumbura, EG Porter, A Divakaran - Metallomics, 2012 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch