.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cnw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of the protein XoxI (Q81AY6) from Bacillus cereus. Northeast Structural Genomics Consortium target BcR196. To Be Published
    Site NESGC
    PDB Id 3cnw Target Id BcR196
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8750,3.30.530.20, PF10604 Molecular Weight 15768.80 Da.
    Residues 140 Isoelectric Point 4.49
    Sequence mnmahtttsmeifgspeqvwqliggfnslpdwlpyipssklteggrvrhlanpdgdtiierlevfndke ryytysimnapfpvtnylstiqvkegtesntslvewsgtftpvevsdeeainlfhgiysdglkalqqaf ld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.48 Rfree 0.258
    Matthews' coefficent 1.93 Rfactor 0.206
    Waters 60 Solvent Content 36.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cnw
    1. Bioinformatics and structural characterization of a hypothetical protein from Streptococcus mutans: implication of antibiotic resistance
    J Nan, E Brostromer, XY Liu, O Kristensen, XD Su - PloS one, 2009 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch