.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cpk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q7W7N7_BORPA protein from Bordetella parapertussis. To be Published
    Site NESGC
    PDB Id 3cpk Target Id BeR31
    Related PDB Ids 2k2e 
    Molecular Characteristics
    Source Bordetella pertussis
    Alias Ids TPS31727,PF04430, 3.40.1230.10, 15702 Molecular Weight 15788.09 Da.
    Residues 150 Isoelectric Point 4.92
    Sequence mklhtdpatalntvtaygdgyievnqvrfshaiafapegpvaswpvqrpaditasllqqaaglaevvrd plafldepeagagarpanapevllvgtgrrqhllgpeqvrpllamgvgveamdtqaaartynilmaegr rvvvallpdgds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.253
    Matthews' coefficent 1.75 Rfactor 0.209
    Waters 44 Solvent Content 29.70

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch