The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the lp_1622 protein from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 3cq9 Target Id LpR114
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8955,, PF04265, PF04263 Molecular Weight 24123.21 Da.
    Residues 219 Isoelectric Point 4.78
    Sequence mativnllvggptanypadlttipgpwvgadrgalrlvkrgiqpvmvvgdfdsidaaelqtvkdalvga ivvkpdqdhtdtqlaiksifeqlqpdevhlygatggrldhllanmwlvldpvfrqwapqiklidkqnsv rfflpgdyqitkeadkrylafvplmpmhltlpdekyqldaaynaypiswasnefsgntghfsfdagvla viqsrddsmada
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.204
    Matthews' coefficent 2.27 Rfactor 0.181
    Waters 741 Solvent Content 45.91

    Ligand Information
    Ligands SO4 (SULFATE) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch