.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cwi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thiamine biosynthesis protein (ThiS) from Geobacter metallireducens. To be Published
    Site NESGC
    PDB Id 3cwi Target Id GmR137
    Related PDB Ids 2k5p 
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS8897,PF02597, 15844, 3.10.20.30 Molecular Weight 7453.97 Da.
    Residues 70 Isoelectric Point 4.19
    Sequence mnltvngkpstvdgaeslnvtellsalkvaqaeyvtvelngevlereafdattvkdgdaveflyfmgggk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.258
    Matthews' coefficent 2.18 Rfactor 0.226
    Waters 45 Solvent Content 43.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cwi
    1. Solution structure of Urm1 from Trypanosoma brucei
    W Zhang, J Zhang, C Xu, T Wang - Proteins: Structure, , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch