.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cwq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of chromosome partitioning protein (ParA) in complex with ADP from Synechocystis sp. To be Published
    Site NESGC
    PDB Id 3cwq Target Id SgR89
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS9137,3.40.50.300, PF01656, PF07015 Molecular Weight 21733.67 Da.
    Residues 201 Isoelectric Point 5.53
    Sequence miitvasfkggvgktttavhlsaylalqgetllidgdpnrsatgwgkrgslpfkvvderqaakyapkyq nividtqarpededlealadgcdllvipstpdalaldalmltietlqklgnnrfrilltiippypskdg dearqllttaglplfkrgikrysafqkaslngvvvsevsdskagiawsdykatgkeiveeilt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.47 Rfree 0.28173
    Matthews' coefficent 2.73 Rfactor 0.22069
    Waters 39 Solvent Content 54.94

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3cwq
    1. The complex process of GETting tail-anchored membrane proteins to the ER
    JW Chartron, WM Clemons, CJM Suloway - Current Opinion in Structural , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch