.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tRNA delta(2)-isopentenylpyrophosphate transferase (SE0981) from Staphylococcus epidermidis. To be Published
    Site NESGC
    PDB Id 3d3q Target Id SeR100
    Molecular Characteristics
    Source Staphylococcus epidermidis
    Alias Ids TPS9122,3.40.50.300, PF01745, PF01715 Molecular Weight 38523.68 Da.
    Residues 332 Isoelectric Point 9.36
    Sequence mtemtkpflivivgptasgktelsievakkfngeiisgdsmqvyqgmdigtakvtteemegiphymidi lppdasfsayefkkraekyikditrrgkvpiiaggtglyiqsllynyafedesisedkmkqvklklkel ehlnnnklheylasfdkesakdihpnnrkrvlraieyylktkkllssrkkvqqftenydtlligiemsr etlylrinkrvdimlghglfnevqhlveqgfeasqsmqaigykelvpvikgnismenaveklkqhsrqy akrqltwfknkmnvhwlnkermslqmmldeittqinkrssnhdckrkhprpstrel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.271
    Matthews' coefficent 2.25 Rfactor 0.231
    Waters 44 Solvent Content 45.44

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d3q
    1. RNA-Protein Mutually Induced Fit
    E Seif, BM Hallberg - Journal of Biological Chemistry, 2009 - ASBMB
     
    2. Snapshots of dynamics in synthesizing N 6-isopentenyladenosine at the tRNA anticodon
    S Chimnaronk, F Forouhar, J Sakai, M Yao - Biochemistry, 2009 - ACS Publications
     
    3. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    4. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    5. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch