.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 4-hydroxybutyrate CoA-transferase (abfT-2) from Porphyromonas gingivalis. To be Published
    Site NESGC
    PDB Id 3d3u Target Id PgR26
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS9024,PF02550, 3.40.1080.10, 3.40.810.20, 3.30.750.70 Molecular Weight 47758.14 Da.
    Residues 431 Isoelectric Point 5.95
    Sequence mqwqelyrqrvcsadeavvdslkpgtkvvfghaaaapvrfsqamyrqreklenitvfhmlyfgdaphla pemrshvhptlnflegnsrpasrdrrvdfipchfhevpelfrqgffpldvavvqvstpneegycsfgvs cdytkaaaecapvvvaevnkqmpfiggenlihisklthiievdepiaevlppaisdlelrigqncasli kdgdtlqlgiggipdavlraleghkdlgihtemftdgvmrmirkgiingkkktlhpekvvtslifgske lydfvnnnpviecypvdyinnpdvigkndrmvsinsclemdlmgqaasesigyeqfsgsggqvdflrga krskggisimafpstakkgtesrivpilkegacvttgrnevdyvvteygvarlrgatlrqraealtaia hpdfrpaleeeirrrfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.25967
    Matthews' coefficent 2.26 Rfactor 0.19863
    Waters 20 Solvent Content 45.48

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d3u
    1. Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
    S Macieira, J Zhang, M Velarde, W Buckel - Biological , 2009 - degruyter.com
     
    2. Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA
    S Macieira, J Zhang, W Buckel - Archives of microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch