.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d5n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q97W15_SULSO protein from Sulfolobus solfataricus. NESG target SsR125. To be Published
    Site NESGC
    PDB Id 3d5n Target Id SsR125
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS9164,3.90.550.10, PF01128 Molecular Weight 21375.14 Da.
    Residues 189 Isoelectric Point 7.66
    Sequence mnigviilaagegkrfggdkllakidntpiimrtiriygdlekiiivgkyvnemlpllmdqiviynpfw negistslklglrffkdydavlvalgdmpfvtkedvnkiintfkpnckavipthkgergnpvliskslf neieklrgdvgarvilnkikieelcfiecsegvlididkkedlmrlrdfhp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.266
    Matthews' coefficent 3.58 Rfactor 0.231
    Waters 33 Solvent Content 65.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d5n
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch