.
The Open Protein Structure Annotation Network
PDB Keyword
.

3da1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the glycerol-3-phosphate dehydrogenase from Bacillus halodurans complexed with FAD. Northeast Structural Genomics Consortium target BhR167. To be Published
    Site NESGC
    PDB Id 3da1 Target Id BhR167
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS8760,PF01494, 3.50.50.60, 3.40.50.720, 3.30.9.10, PF01266 Molecular Weight 62037.56 Da.
    Residues 553 Isoelectric Point 6.00
    Sequence mfsakkrdkcigemsekqldllvigggitgagialdaqvrgiqtglvemndfasgtssrstklvhgglr ylkqfeiklvaevgkeraivyenaphvttpewmllpifkdgtfgkfstslglkvydyladvrkderrym lnekqtlekepllrkenlkgggiyveyrtddarltleimkeavargavalnymkvesfiydqgkvvgvv akdrltdtthtiyakkvvnaagpwvdtlrekdrskhgkylklskgvhlvvdqsrfplrqavyfdtesdg rmifaipregktyigttdtfydkdiasprmtvedrdyilaaanymfpslnltaddvesswaglrplihe egkkaseisrkdeiffsdsglisiaggkltgyrkmaertvdavaqglnvnepcttaairlsgglaegaq gfprfldeasrkgaklgfdadevrrlaklygsnvdhvlnyayegkeeaehyglpalllgqlqygveqem vatpldffvrrtgalffnislvhqwkeavlrwmaeefswteeektrfqneletelkmavdplfqvepttv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.282
    Matthews' coefficent 2.26 Rfactor 0.222
    Waters 36 Solvent Content 45.63

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3da1
    1. Comparison of structure_based and threading_based approaches to protein functional annotation
    M Brylinski, J Skolnick - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. CONCLUSIONS AND FUTURE DIRECTIONS
    T Colussi - BIOCHEMICAL STUDIES OF Streptococcus sp. _ , 2009 - wakespace.lib.wfu.edu
     
    3. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch