.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dc7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein Q88SR8 from Lactobacillus plantarum. Northeast Structural Genomics consortium target LpR109. (CASP Target). To be Published
    Site NESGC
    PDB Id 3dc7 Target Id LpR109
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8954,3.40.50.1110 Molecular Weight 24190.94 Da.
    Residues 224 Isoelectric Point 5.29
    Sequence miamivkgglamaisnghvsfkrpawlgdsitannglatvhyhdilaadwdversdnlgisgstigsry damavryqaipedadfiavfggvndygrdqplgqygdcdmttfygalmmlltglqtnwptvpklfisai higsdfggsfsavtnglgyrqsdyeaaiaqmtadygvphlslyrdagmtfaipaqaaiysvdtlhpnna ghrviarklqsfldshf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.12 Rfree 0.22431
    Matthews' coefficent 2.01 Rfactor 0.18388
    Waters 155 Solvent Content 38.71

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals NA (SODIUM) x 2;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3dc7
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch