.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dcd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of the galactose mutarotase related enzyme Q5FKD7 from Lactobacillus acidophilus at the resolution 1.9A. Northeast Structural Genomics consortium target LaR33. (CASP Target). To be Published
    Site NESGC
    PDB Id 3dcd Target Id LaR33
    Molecular Characteristics
    Source Lactobacillus acidophilus
    Alias Ids TPS8945,2.70.98.10, PF01263 Molecular Weight 34681.95 Da.
    Residues 299 Isoelectric Point 5.22
    Sequence mdytiennmikvvisdhgaeiqsvksahtdeefmwqanpeiwgrhapvlfpivgrlkndeytykgktyh lgqhgfarnadfevenhtkesitfllkdneetrkvypfkfefrvnynlmnnlleenfsvvnksdetmif gvgghpgfnlptdhgenkedfyfdmhpsvtrvriplkdasldwnnrslaptdslialsddlfkddaliy elrgndnkvslrtdknkfhvnvwtrdapfvgiwsqypktdnyvciepwwgiadrddadgdlehkygmnh lkpgkefqagfsmtyhsttdevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.20607
    Matthews' coefficent 2.27 Rfactor 0.17792
    Waters 487 Solvent Content 45.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dcd
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch