.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dcp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the putative histidinol phosphatase hisK from Listeria monocytogenes. To be Published
    Site NESGC
    PDB Id 3dcp Target Id LmR141
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS8952,3.20.20.140 Molecular Weight 31311.53 Da.
    Residues 275 Isoelectric Point 4.81
    Sequence mkrdghthtefcphgthddveemilkaieldfdeysivehaplsrefmnntagdkeavttasmamsdlp yyfkkmnhikkkyasdllihigfevdyligyedftrdfldeygpqtddgvlslhflegqggfrsidfsa edynegivqfyggfeqaqltylegvkqsieadlglfkprrighislcqkfqqffgadtsnfsgevmeef qailalvkkrdyeldfntaglfkslcgetyppkeivtlarelkiplvygsdshgvqdigrgyntycqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.212
    Matthews' coefficent 2.58 Rfactor 0.193
    Waters 678 Solvent Content 52.23

    Ligand Information
    Ligands
    Metals FE (FE) x 6;ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 3dcp
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    2. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch