.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dev

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SH1221 protein from Staphylococcus haemolyticus, Northeast Structural Genomics Consortium Target ShR87. To be Published
    Site NESGC
    PDB Id 3dev Target Id ShR87
    Molecular Characteristics
    Source Staphylococcus haemolyticus
    Alias Ids TPS9138,3.90.1640.10, PF01368, PF02272 Molecular Weight 35200.54 Da.
    Residues 312 Isoelectric Point 4.67
    Sequence mveifneimqrvkeaetiiihrhvrpdpdaygsqlglklylerkfpekniyatgeaepslsfigdldei ddsvysdalvivcdtanapriddqrylngqslikidhhpatdqygdvnfvnteasstseiifdfishfn dlsiidehvarvlylgivgdtgrflfsntsphtmevasqllaypfnhnaelnkmsekdpklmpfqgyvl qnfelsdsheycqikitndvlkqfdiqpneasqfvntvadisglkiwmfgvdegdqircrirskgitin dvanqfgggghpnasgvsvyswdefeelaqalrqkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.10 Rfree 0.245
    Matthews' coefficent 3.82 Rfactor 0.193
    Waters 36 Solvent Content 67.82

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3dev
    1. Role of RecJ-like protein with 5_-3_ exonuclease activity in oligo (deoxy) nucleotide degradation
    T Wakamatsu, K Kim, Y Uemura, N Nakagawa - Journal of Biological , 2011 - ASBMB
     
    2. Ranking Beta Sheet Topologies with Applications to Protein Structure Prediction
    R Fonseca, G Helles, P Winter - Journal of Mathematical Modelling and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch