.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dex

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SAV_2001 protein from Streptomyces avermitilis, Northeast Structural Genomics Consortium Target SvR107. To be Published
    Site NESGC
    PDB Id 3dex Target Id SvR107
    Molecular Characteristics
    Source Streptomyces avermitilis
    Alias Ids TPS9181,PF10262, 3.40.30.10 Molecular Weight 11354.45 Da.
    Residues 99 Isoelectric Point 6.83
    Sequence mvgaprmttphthrvqieyctqcrwlpraawlaqellttfeteltelalkpgtggvfvvrvddevvwdr reqgfpeptavkrlvrdrvapekslghser
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.264
    Matthews' coefficent 1.84 Rfactor 0.230
    Waters Solvent Content 33.16

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dex
    1. A machine-learning approach for predicting B-cell epitopes
    ND Rubinstein, I Mayrose, T Pupko - Molecular immunology, 2009 - Elsevier
     
    2. Inducing cross-clade neutralizing antibodies against HIV-1 by immunofocusing
    M Humbert, RA Rasmussen, H Ong, FMP Kaiser - PLoS One, 2008 - dx.plos.org
     
    3. Automated detection of conformational epitopes using phage display peptide sequences
    SS Negi, W Braun - Bioinformatics and biology insights, 2009 - ncbi.nlm.nih.gov
     
    4. MimoDB: a new repository for mimotope data derived from phage display technology
    B Ru, J Huang, P Dai, S Li, Z Xia, H Ding, H Lin - Molecules, 2010 - mdpi.com
     
    5. Characterization of IgE epitopes of Cuc m 2, the major melon allergen, and their role in cross_reactivity with pollen profilins
    L Tordesillas, LF Pacios, A Palacin - Clinical & , 2010 - Wiley Online Library
     
    6. Bioinformatics resources and tools for phage display
    J Huang, B Ru, P Dai - Molecules, 2011 - mdpi.com
     
    7. Epitope prediction based on random peptide library screening: benchmark dataset and prediction tools evaluation
    P Sun, W Chen, Y Huang, H Wang, Z Ma, Y Lv - Molecules, 2011 - mdpi.com
     
    8. MimoPro: a more efficient Web-based tool for epitope prediction using phage display libraries
    WH Chen, PP Sun, Y Lu, WW Guo - BMC , 2011 - biomedcentral.com
     
    9. Immunoinformatics: an integrated scenario
    N Tomar, RK De - Immunology, 2010 - Wiley Online Library
     
    10. Identification of Peptide Mimotopes of Trypanosoma brucei gambiense Variant Surface Glycoproteins
    LC Van Nieuwenhove, S Rog, F Balharbi - PLoS neglected tropical , 2011 - dx.plos.org
     
    11. Information loss and noise inclusion risk in mimotope based epitope mapping
    J Huang, M Xia, H Lin, F Guo - Bioinformatics and Biomedical , 2009 - ieeexplore.ieee.org
     
    12. Design of antibody-reactive peptides from discontinuous parts of scorpion toxins
    L Alvarenga, V Moreau, L Felicori, C Nguyen, C Duarte - Vaccine, 2010 - Elsevier
     
    13. LocaPep: localization of epitopes on protein surfaces using peptides from phage display libraries
    LF Pacios, L Tordesillas, A Palac n - Journal of chemical , 2011 - ACS Publications
     
    14. B cell epitope prediction
    JV Ponomarenko, MHV Van Regenmortel - Structural Bioinformatics, 2009 - sdsc.edu
     
    15. Phage display-directed discovery of LEDGF/p75 binding cyclic peptide inhibitors of HIV replication
    BA Desimmie, M Humbert, E Lescrinier, J Hendrix - Molecular , 2012 - nature.com
     
    16. T-cell Epitopes of Mycobacterium tuberculosis Antigen 85 Complex Potential for Generating Antibody: an Immunoinformatics Study
    Y Simanjuntak - Microbiology Indonesia, 2009 - jurnal.permi.or.id
     
    17. Ranking Beta Sheet Topologies with Applications to Protein Structure Prediction
    R Fonseca, G Helles, P Winter - Journal of Mathematical Modelling and , 2011 - Springer
     
    18. Identification of Mimotopes with Diagnostic Potential for Trypanosoma brucei gambiense Variant Surface Glycoproteins Using Human Antibody Fractions
    L Van Nieuwenhove, P Bscher, F Balharbi - PLoS Neglected , 2012 - dx.plos.org
     
    19. TCP: a tool for designing chimera proteins based on the tertiary structure information
    T Yoneya, R Nishida - BMC bioinformatics, 2009 - biomedcentral.com
     
    20. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    21. MIMOTOPES OF HIV ENV
    RM Ruprecht, M Humbert - US Patent App. 13/075,761, 2011 - Google Patents
     
    22. Medicinal protein engineering
    YE Khudyakov - 2008 - books.google.com
     
    23. Phages and HIV-1: From Display to Interplay
    S Delhalle, JC Schmit, A Chevign - International Journal of Molecular , 2012 - mdpi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch