.
The Open Protein Structure Annotation Network
PDB Keyword
.

3djb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a HD-superfamily hydrolase (BT9727_1981) from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR114. To be Published
    Site NESGC
    PDB Id 3djb Target Id BuR114
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS8784,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 24790.95 Da.
    Residues 215 Isoelectric Point 5.69
    Sequence mtkqekiektitfvkhilekdasghdwyhiervhklaislseqeggnrfiiemaallhdvadeklnese eagmkkvsdwleelhveeeeskhvlhiianmsykgghggkvesiegkivqdadrldalgaigiartfay ggakgrlmydptipprevmtkdeyrknndpslnhfyekllklkdlmntnaakqeaevrhrymeqfieqf mkewnaqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.291
    Matthews' coefficent 2.11 Rfactor 0.246
    Waters 12 Solvent Content 41.82

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3djb
    1. FunFOLD: an improved automated method for the prediction of ligand binding residues using 3D models of proteins
    D Roche, S Tetchner, L McGuffin - BMC bioinformatics, 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch