.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dkz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Q7W9W5_BORPA protein from Bordetella parapertussis. To be Published
    Site NESGC
    PDB Id 3dkz Target Id BpR208C
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS8774,PF03061, 3.10.129.10 Molecular Weight 14127.32 Da.
    Residues 133 Isoelectric Point 6.80
    Sequence stphtdffgltipfmqllgvvpehsgngtartrlparadlvnsrgdihggtlmsvldftlgaairgdtp evgvatidmntsfmspgrgdlvietrclrrgasiafcegeirdsagelvakatatfkiiqrrpg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.26
    Matthews' coefficent 2.42 Rfactor 0.238
    Waters 68 Solvent Content 49.21

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dkz
    1. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    2. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    3. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    4. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch