.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dl3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the tellurite resistance protein TehB. Northeast Structural Genomics Consortium target VfR98. To be Published
    Site NESGC
    PDB Id 3dl3 Target Id VfR98
    Molecular Characteristics
    Source Vibrio fischeri
    Alias Ids TPS9235,BIG_653, PF09313, 2.60.120.10 Molecular Weight 12723.71 Da.
    Residues 111 Isoelectric Point 6.03
    Sequence mshlripknwtiqrstpfftkdnvpeallthhntavdvfgqicvmegvvtyygfanseatepeikvvin agqfatsppqywhrielsddaqfninfwsdqdksgkkmfntk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.274
    Matthews' coefficent 2.12 Rfactor 0.232
    Waters 84 Solvent Content 41.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dl3
    1. Predicting protein ligand binding sites by combining evolutionary sequence conservation and 3D structure
    JA Capra, RA Laskowski, JM Thornton - PLoS computational , 2009 - dx.plos.org
     
    2. Tellurite: history, oxidative stress, and molecular mechanisms of resistance
    TG Chasteen, DE Fuentes - FEMS microbiology , 2009 - Wiley Online Library
     
    3. Human-specific evolution and adaptation led to major qualitative differences in the variable receptors of human and chimpanzee natural killer cells
    L Abi-Rached, AK Moesta, R Rajalingam, LA Guethlein - PLoS genetics, 2010 - dx.plos.org
     
    4. Killer cell immunoglobulin-like receptor 3DL1-mediated recognition of human leukocyte antigen B
    JP Vivian, RC Duncan, R Berry, GM O'Connor - Nature, 2011 - nature.com
     
    5. Human-specific evolution of killer cell immunoglobulin-like receptor recognition of major histocompatibility complex class I molecules
    P Parham, PJ Norman - of the Royal , 2012 - rstb.royalsocietypublishing.org
     
    6. The NsrR regulon in nitrosative stress resistance of Salmonella enterica serovar Typhimurium
    JE Karlinsey, IS Bang, LA Becker - Molecular , 2012 - Wiley Online Library
     
    7. KIR-BINDING AGENTS AND METHODS OF USE THEREOF
    SB Padkr, PANR Wagtmann, P Spee - EP Patent , 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch